PDB entry 1xvf

View 1xvf on RCSB PDB site
Description: soluble methane monooxygenase hydroxylase: chloropropanol soaked structure
Class: oxidoreductase
Keywords: methane, diiron, four-helix bundle, cavities, product
Deposited on 2004-10-27, released 2005-05-03
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methane monooxygenase component A alpha chain
    Species: Methylococcus capsulatus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xvfa1
  • Chain 'B':
    Compound: Methane monooxygenase component A alpha chain
    Species: Methylococcus capsulatus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xvfb1
  • Chain 'C':
    Compound: Methane monooxygenase component A beta chain
    Species: Methylococcus capsulatus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xvfc1
  • Chain 'D':
    Compound: Methane monooxygenase component A beta chain
    Species: Methylococcus capsulatus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xvfd1
  • Chain 'E':
    Compound: Methane monooxygenase component A gamma chain
    Species: Methylococcus capsulatus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xvfe1
  • Chain 'F':
    Compound: Methane monooxygenase component A gamma chain
    Species: Methylococcus capsulatus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xvff1
  • Heterogens: FE, 3CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xvfA (A:)
    malstatkaatdalaanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqf
    kliakeyarmeavkderqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaa
    tgmlwdsaqaaeqkngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigpl
    wkgmkrvfsdgfisgdavecslnlqlvgeacftnplivavtewaaangdeitptvflsie
    tdelrhmangyqtvvsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvep
    wvktwdrwvyedwggiwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffr
    lalpdqeemewfeanypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrv
    sqvpfcpslakgastlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelse
    viaelhglrsdgktliaqphvrgdklwtlddikrlncvfknpvkafn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvfA (A:)
    raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
    qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
    laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
    vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
    andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
    igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
    gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
    vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
    qphvrgdklwtlddikrlncvfknpvkafn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xvfB (B:)
    malstatkaatdalaanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqf
    kliakeyarmeavkderqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaa
    tgmlwdsaqaaeqkngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigpl
    wkgmkrvfsdgfisgdavecslnlqlvgeacftnplivavtewaaangdeitptvflsie
    tdelrhmangyqtvvsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvep
    wvktwdrwvyedwggiwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffr
    lalpdqeemewfeanypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrv
    sqvpfcpslakgastlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelse
    viaelhglrsdgktliaqphvrgdklwtlddikrlncvfknpvkafn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvfB (B:)
    raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
    qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
    laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
    vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
    andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
    igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
    gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
    vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
    qphvrgdklwtlddikrlncvfknpvkafn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xvfC (C:)
    msmlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpna
    dwiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewryt
    drflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvsla
    fwgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfd
    wnesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyy
    nclgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvv
    ddwiedyasridfkadrdqivkavlaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvfC (C:)
    smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
    wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
    rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
    wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
    nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
    clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
    dwiedyasridfkadrdqivkavlaglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xvfD (D:)
    msmlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpna
    dwiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewryt
    drflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvsla
    fwgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfd
    wnesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyy
    nclgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvv
    ddwiedyasridfkadrdqivkavlaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvfD (D:)
    smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
    wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
    rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
    wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
    nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
    clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
    dwiedyasridfkadrdqivkavlaglk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xvfE (E:)
    maklgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakl
    eekvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykp
    pimpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvfE (E:)
    klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
    kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
    mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xvfF (F:)
    maklgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakl
    eekvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykp
    pimpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xvfF (F:)
    lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
    vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
    pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp