PDB entry 1xuo

View 1xuo on RCSB PDB site
Description: X-ray structure of LFA-1 I-domain bound to a 1,4-diazepane-2,5-dione inhibitor at 1.8A resolution
Class: immune system
Keywords: I-domain, Integrin, IMMUNE SYSTEM
Deposited on 2004-10-26, released 2005-10-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701
      • see remark 999 (65)
    Domains in SCOPe 2.03: d1xuoa_
  • Chain 'B':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701
      • see remark 999 (65)
    Domains in SCOPe 2.03: d1xuob_
  • Heterogens: MG, LA1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xuoA (A:)
    maskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdf
    sdyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeat
    dsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelq
    kkiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xuoA (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xuoB (B:)
    maskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdf
    sdyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeat
    dsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelq
    kkiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xuoB (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftel