PDB entry 1xtr

View 1xtr on RCSB PDB site
Description: Structure of small GTPase human Rheb in complex with GppNHp
Class: signaling protein
Keywords: beta saddle, P-loop, SIGNALING PROTEIN
Deposited on 2004-10-24, released 2005-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein Rheb
    Species: Homo sapiens [TaxId:9606]
    Gene: Rheb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15382 (Start-168)
      • expression tag (169-170)
    Domains in SCOPe 2.08: d1xtra2, d1xtra3
  • Heterogens: MG, GNP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xtrA (A:)
mpqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvd
tagqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnk
kdlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaeklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1xtrA (A:)
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkk
dlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaekle