PDB entry 1xtg

View 1xtg on RCSB PDB site
Description: Crystal structure of NEUROTOXIN BONT/A complexed with Synaptosomal-associated protein 25
Class: toxin
Keywords: botox, botulism, exosites, toxin
Deposited on 2004-10-21, released 2004-12-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin BoNT/A
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAQ06331 (0-418)
      • engineered (222)
      • engineered (364)
      • cloning artifact (419-423)
    Domains in SCOPe 2.04: d1xtga_
  • Chain 'B':
    Compound: synaptosomal-associated protein 25
    Species: Homo sapiens [TaxId:9606]
    Gene: SNAP25, SNAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xtgb_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtgA (A:)
    pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
    ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
    tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
    stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahqlihaghrlygiainpnr
    vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
    sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
    nrktflnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftp
    lvpr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtgB (B:)
    mdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnktrideanqratkmlg