PDB entry 1xta

View 1xta on RCSB PDB site
Description: Crystal Structure of Natrin, a snake venom CRISP from Taiwan cobra (Naja atra)
Class: toxin
Keywords: natrin, CRISP, serine protease, ion channel blocking, naja atra, cobra, TOXIN
Deposited on 2004-10-21, released 2005-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.223
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Natrin 1
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7T1K6 (Start-220)
      • conflict (106)
    Domains in SCOPe 2.06: d1xtaa1, d1xtaa2
  • Chain 'B':
    Compound: Natrin 1
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7T1K6 (Start-220)
      • conflict (106)
    Domains in SCOPe 2.06: d1xtab1, d1xtab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtaA (A:)
    nvdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnh
    spdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvgasppgsvtghytqiv
    wyqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglct
    npctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtaA (A:)
    vdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhs
    pdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvgasppgsvtghytqivw
    yqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglctn
    pctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xtaB (B:)
    nvdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnh
    spdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvgasppgsvtghytqiv
    wyqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglct
    npctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtaB (B:)
    dfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhsp
    dnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvgasppgsvtghytqivwy
    qtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglctnp
    ctiynkltncdsllkqsscqddwiksncpascfcrnkii