PDB entry 1xt9

View 1xt9 on RCSB PDB site
Description: Crystal Structure of Den1 in complex with Nedd8
Deposited on 2004-10-21, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xt9a_
  • Chain 'B':
    Domains in SCOP 1.71: d1xt9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xt9A (A:)
    mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtq
    fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhyds
    hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
    qqtesllqlltpayitkkrgewkdlittlakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xt9A (A:)
    dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtqf
    ikctsneiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhydshsr
    snsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrqqt
    esllqlltpayitkkrgewkdlittlak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xt9B (B:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg