PDB entry 1xsx

View 1xsx on RCSB PDB site
Description: NMR Structure of Sso10a, a Hyperthermophile DNA-binding Protein with an Extended Anti-parallel Coiled Coil
Class: DNA binding protein
Keywords: winged helix-turn-helix, anti-parallel coiled coil dimer, hyperthermophile DNA-binding protein
Deposited on 2004-10-20, released 2005-03-01
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sso10a
  Species: Sulfolobus solfataricus
  Gene: Sso10a
  Domains in SCOP 1.75: d1xsxa1
• Chain 'B':
  Compound: Sso10a
  Species: Sulfolobus solfataricus
  Gene: Sso10a
  Domains in SCOP 1.75: d1xsxb1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xsxA (A:)
  akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
  kkgeelledirkfnemrknmdqlkekinsvlsirq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xsxB (B:)
  akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
  kkgeelledirkfnemrknmdqlkekinsvlsirq