PDB entry 1xsn

View 1xsn on RCSB PDB site
Description: Crystal Structure of human DNA polymerase lambda in complex with a one nucleotide DNA gap and ddTTP
Class: transferase/DNA
Keywords: DNA POLYMERASE LAMBDA, Protein-DNA complex, Helix-hairpin-helix, TRANSFERASE/DNA COMPLEX
Deposited on 2004-10-19, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.213
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-334)
      • engineered (302)
    Domains in SCOPe 2.07: d1xsna1, d1xsna2, d1xsna3
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'P':
    Compound: 5'-d(*cp*ap*gp*tp*ap*(2dt))-3'
    Species: synthetic, synthetic
  • Chain 'T':
    Compound: 5'-d(*cp*gp*gp*cp*ap*ap*tp*ap*cp*tp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: MG, NA, D3T, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xsnA (A:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgakvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsnA (A:)
    hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
    kiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasltt
    qqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvl
    ithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldi
    ivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgakvgpgrvl
    ptptekdvfrllglpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.