PDB entry 1xsm

View 1xsm on RCSB PDB site
Description: protein r2 of ribonucleotide reductase from mouse
Class: oxidoreductase
Keywords: oxidoreductase, DNA replication, iron
Deposited on 1996-07-03, released 1997-01-11
The last revision prior to the SCOP 1.73 freeze date was dated 1997-01-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleotide reductase r2
    Species: MUS MUSCULUS
    Gene: NRDD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xsma_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xsmA (A:)
    mlsvrtplatiadqqqlqlsplkrltladkentpptlsstrvlaskaarrifqdsaeles
    kaptnpsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhweal
    kpderhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysll
    idtyikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgs
    fasifwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavri
    eqefltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfmenislegkt
    nffekrvgeyqrmgvmsnstensftldadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsmA (A:)
    npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde
    rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty
    ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi
    fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef
    ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme