PDB entry 1xsl

View 1xsl on RCSB PDB site
Description: Crystal Structure of human DNA polymerase lambda in complex with a one nucleotide DNA gap
Class: transferase/DNA
Keywords: DNA POLYMERASE LAMBDA, Protein-DNA complex, Helix-hairpin-helix, TRANSFERASE-DNA COMPLEX
Deposited on 2004-10-19, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xsla1, d1xsla2, d1xsla3
  • Chain 'B':
    Compound: 5'-d(*cp*gp*gp*cp*ap*gp*cp*gp*cp*ap*c)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*gp*tp*gp*cp*gp*c)-3'
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xsle1, d1xsle2, d1xsle3
  • Chain 'F':
    Compound: 5'-d(*cp*gp*gp*cp*ap*gp*cp*gp*cp*ap*c)-3'
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 5'-d(*gp*tp*gp*cp*gp*c)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'I':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xsli1, d1xsli2, d1xsli3
  • Chain 'J':
    Compound: 5'-d(*cp*gp*gp*cp*ap*gp*cp*gp*cp*ap*c)-3'
    Species: synthetic, synthetic
  • Chain 'K':
    Compound: 5'-d(*gp*tp*gp*cp*gp*c)-3'
    Species: synthetic, synthetic
  • Chain 'L':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
    Species: synthetic, synthetic
  • Chain 'M':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xslm1, d1xslm2, d1xslm3
  • Chain 'N':
    Compound: 5'-d(*cp*gp*gp*cp*ap*gp*cp*gp*cp*ap*c)-3'
    Species: synthetic, synthetic
  • Chain 'O':
    Compound: 5'-d(*gp*tp*gp*cp*gp*c)-3'
    Species: synthetic, synthetic
  • Chain 'P':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: NA, MG, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xslA (A:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xslA (A:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpg
    rvlptptekdvfrllglpyrepaerdw
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xslE (E:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xslE (E:)
    nhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrma
    ekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslt
    tqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdv
    lithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrld
    iivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrv
    lptptekdvfrllglpyrepaerdw
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xslI (I:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xslI (I:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdw
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1xslM (M:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgckvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xslM (M:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpg
    rvlptptekdvfrllglpyrepaerdw
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.