SCOPe 2.05: Structural Classification of Proteins

PDB entry 1xsk

View 1xsk on RCSB PDB site
Description: Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate
Class: hydrolase
Keywords: beta(8)alpha(8) barrel and beta sandwich domains, hydrolase
Deposited on 2004-10-19, released 2004-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.05: d1xska1, d1xska2, d1xska3, d1xska4
Chain 'B':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.05: d1xskb1, d1xskb2, d1xskb3, d1xskb4
Chain 'C':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.05: d1xskc1, d1xskc2, d1xskc3, d1xskc4
Chain 'D':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.05: d1xskd1, d1xskd2, d1xskd3, d1xskd4
Chain 'E':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.05: d1xske1, d1xske2, d1xske3, d1xske4
Chain 'F':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.05: d1xskf1, d1xskf2, d1xskf3, d1xskf4
Heterogens: SO4, XYF, MPO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1xskA (A:)
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh