PDB entry 1xrv

View 1xrv on RCSB PDB site
Description: Crystal Structure of the novel secretory signalling protein from Porcine (SPP-40) at 2.1A resolution.
Class: signaling protein
Keywords: Signalling Protein, Porcine, 2.1A resolution, SIGNALING PROTEIN
Deposited on 2004-10-16, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal processing protein
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAV30548 (0-360)
    Domains in SCOPe 2.07: d1xrva1, d1xrva2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xrvA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptfg
    ksftlassktdvgapvsgpgipgqftkekgilayyeicdflqgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar
    a