PDB entry 1xru

View 1xru on RCSB PDB site
Description: Crystal Structure of 5-keto-4-deoxyuronate Isomerase from Eschericia coli
Class: isomerase
Keywords: beta barrel, cupin
Deposited on 2004-10-15, released 2005-04-05
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.164
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
    Species: Escherichia coli
    Gene: kduI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46938 (3-280)
      • cloning artifact (0-2)
      • modified residue (39)
      • modified residue (53)
      • modified residue (181)
      • modified residue (195)
      • modified residue (204)
      • modified residue (212)
      • modified residue (221-222)
      • modified residue (233)
      • modified residue (261)
      • modified residue (271)
      • see remark 999 (278-280)
    Domains in SCOP 1.75: d1xrua1
  • Chain 'B':
    Compound: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
    Species: Escherichia coli
    Gene: kduI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46938 (3-280)
      • cloning artifact (0-2)
      • modified residue (39)
      • modified residue (53)
      • modified residue (181)
      • modified residue (195)
      • modified residue (204)
      • modified residue (212)
      • modified residue (221-222)
      • modified residue (233)
      • modified residue (261)
      • modified residue (271)
      • see remark 999 (278-280)
    Domains in SCOP 1.75: d1xrub1
  • Heterogens: ZN, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xruA (A:)
    gsamdvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktv
    svggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfas
    idtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcql
    smgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqav
    ispswsihsgvgtkaytfiwgmvgenqvfddmdhvavkeica
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xruA (A:)
    gsamdvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktv
    svggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfas
    idtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcql
    smgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqav
    ispswsihsgvgtkaytfiwgmvgenqvfddmdhvavkeic
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xruB (B:)
    gsamdvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktv
    svggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfas
    idtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcql
    smgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqav
    ispswsihsgvgtkaytfiwgmvgenqvfddmdhvavkeica
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xruB (B:)
    gsamdvrqsihsahaktldtqglrneflvekvfvadeytmvyshidriivggimpitktv
    svggevgkqlgvsyflerrelgviniggagtitvdgqcyeighrdalyvgkgakevvfas
    idtgtpakfyyncapahttyptkkvtpdevspvtlgdnltsnrrtinkyfvpdvletcql
    smgltelapgnlwntmpchtherrmevyfyfnmdddacvfhmmgqpqetrhivmhneqav
    ispswsihsgvgtkaytfiwgmvgenqvfddmdhvavkeic