PDB entry 1xre

View 1xre on RCSB PDB site
Description: Crystal Structure of SodA-2 (BA5696) from Bacillus anthracis at 1.8A Resolution.
Class: oxidoreductase
Keywords: SodA-2; Superoxide dismutase; Bacillus anthracis; BA5696; SPINE, OXIDOREDUCTASE
Deposited on 2004-10-14, released 2005-07-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: sodA2, sodA-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xrea1, d1xrea2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: sodA2, sodA-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xreb1, d1xreb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xreA (A:)
    gsshhhhhhmssfqlpklsydydelepyidsntlsihhgkhhatyvnnlnaalenyselh
    nksleellcnletlpkeivtavrnnggghychslfwevmsprgggepngdvakvidyyfn
    tfdnlkdqlskaaisrfgsgygwlvldgeelsvmstpnqdtplqegkipllvidvwehay
    ylkyqnrrpefvtnwwhtvnwdrvnekylqaiqsqkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xreA (A:)
    sfqlpklsydydelepyidsntlsihhgkhhatyvnnlnaalenyselhnksleellcnl
    etlpkeivtavrnnggghychslfwevmsprgggepngdvakvidyyfntfdnlkdqlsk
    aaisrfgsgygwlvldgeelsvmstpnqdtplqegkipllvidvwehayylkyqnrrpef
    vtnwwhtvnwdrvnekylqai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xreB (B:)
    gsshhhhhhmssfqlpklsydydelepyidsntlsihhgkhhatyvnnlnaalenyselh
    nksleellcnletlpkeivtavrnnggghychslfwevmsprgggepngdvakvidyyfn
    tfdnlkdqlskaaisrfgsgygwlvldgeelsvmstpnqdtplqegkipllvidvwehay
    ylkyqnrrpefvtnwwhtvnwdrvnekylqaiqsqkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xreB (B:)
    sfqlpklsydydelepyidsntlsihhgkhhatyvnnlnaalenyselhnksleellcnl
    etlpkeivtavrnnggghychslfwevmsprgggepngdvakvidyyfntfdnlkdqlsk
    aaisrfgsgygwlvldgeelsvmstpnqdtplqegkipllvidvwehayylkyqnrrpef
    vtnwwhtvnwdrvnekylqai