PDB entry 1xrb

View 1xrb on RCSB PDB site
Description: S-adenosylmethionine synthetase (MAT, ATP: L-methionine S-adenosyltransferase, E.C.2.5.1.6) in which MET residues are replaced with selenomethionine residues (MSE)
Class: transferase
Keywords: methyltransferase
Deposited on 1995-10-26, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.188
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylmethionine synthetase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xrba1, d1xrba2, d1xrba3
  • Heterogens: PO4, MG, K

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xrbA (A:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrbA (A:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdradpleqgagdqglmfgya
    tnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgidavvls
    tqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcgltgrki
    ivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsyaigvae
    ptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghfgrehfp
    wektdkaqllrdaaglk