PDB entry 1xra

View 1xra on RCSB PDB site
Description: crystal structure of s-adenosylmethionine synthetase
Class: methyltransferase
Keywords: methyltransferase
Deposited on 1995-10-26, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.189
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xraa1, d1xraa2, d1xraa3
  • Heterogens: PO4, MG, K

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xraA (A:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xraA (A:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdradpleqgagdqglmfgya
    tnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgidavvls
    tqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcgltgrki
    ivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsyaigvae
    ptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghfgrehfp
    wektdkaqllrdaaglk