PDB entry 1xr0

View 1xr0 on RCSB PDB site
Description: Structural Basis of SNT PTB Domain Interactions with Distinct Neurotrophic Receptors
Class: signaling protein/growth factor receptor
Keywords: FGFR, SNT, phosphotyrosine binding domain, PTB, TRK, NPXpY motif,, SIGNALING PROTEIN/GROWTH FACTOR RECEPTOR COMPLEX
Deposited on 2004-10-13, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic fibroblast growth factor receptor 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: FGFR signalling adaptor SNT-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WU20 (3-128)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1xr0b1, d1xr0b2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xr0B (B:)
mgsdtvpdnhrnkfkvinvdddgnelgsgimeltdtelilytrkrdsvkwhylclrrygy
dsnlfsfesgrrcqtgqgifafkcaraeelfnmlqeimqnnsinvveepvvernnhqtel
evprtprtp