PDB entry 1xqc

View 1xqc on RCSB PDB site
Description: X-ray structure of ERalpha LBD bound to a tetrahydroisoquinoline SERM ligand at 2.05A resolution
Class: HORMONE receptor
Keywords: alpha-helical sandwich, nuclear hormone receptor, ligand binding domain
Deposited on 2004-10-12, released 2005-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (81)
      • engineered (117)
    Domains in SCOPe 2.06: d1xqca_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (81)
      • engineered (117)
    Domains in SCOPe 2.06: d1xqcb_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (81)
      • engineered (117)
    Domains in SCOPe 2.06: d1xqcc_
  • Chain 'D':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (81)
      • engineered (117)
    Domains in SCOPe 2.06: d1xqcd_
  • Heterogens: AEJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xqcA (A:)
    mskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhmin
    wakrvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksve
    gmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvl
    dkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydl
    llemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqcA (A:)
    alsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdqv
    hllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrfr
    mmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagltlq
    qqhqrlaqlllilshirhmsnkgmehlysmplydlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xqcB (B:)
    mskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhmin
    wakrvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksve
    gmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvl
    dkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydl
    llemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqcB (B:)
    alsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdqv
    hllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrfr
    mmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagltlq
    qqhqrlaqlllilshirhmsnkgmehlplydlllemldahr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xqcC (C:)
    mskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhmin
    wakrvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksve
    gmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvl
    dkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydl
    llemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqcC (C:)
    alsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdqv
    hllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrfr
    mmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagltlq
    qqhqrlaqlllilshirhmsnkgmehlysmplydlllemldahr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xqcD (D:)
    mskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhmin
    wakrvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksve
    gmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvl
    dkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydl
    llemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xqcD (D:)
    alsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdqv
    hllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrfr
    mmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagltlq
    qqhqrlaqlllilshirhmsnkgmehlplydlllemldahr