PDB entry 1xq5

View 1xq5 on RCSB PDB site
Description: Met-Perch Hemoglobin at 1.9A
Deposited on 2004-10-11, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.246
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xq5a_
  • Chain 'B':
    Domains in SCOP 1.71: d1xq5b_
  • Chain 'C':
    Domains in SCOP 1.71: d1xq5c_
  • Chain 'D':
    Domains in SCOP 1.71: d1xq5d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq5A (A:)
    slsskdkdtvkalwgkiadkaeeigsdalsrmlavypqtktyfshwkdlspgsapvnkhg
    ktimggivdavasiddlnagllalselhaftlrvdpanfkilshcilvllavkfpkdftp
    evhisydkffsalaralaekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq5B (B:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
    akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
    afsgevqaafqkflsvvvsalgkqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq5C (C:)
    slsskdkdtvkalwgkiadkaeeigsdalsrmlavypqtktyfshwkdlspgsapvnkhg
    ktimggivdavasiddlnagllalselhaftlrvdpanfkilshcilvllavkfpkdftp
    evhisydkffsalaralaekyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xq5D (D:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
    akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
    afsgevqaafqkflsvvvsalgkqyh