PDB entry 1xp6

View 1xp6 on RCSB PDB site
Description: human estrogen receptor alpha ligand-binding domain in complex with compound 16
Class: hormone/growth factor receptor
Keywords: nuclear receptor, transcription factor, er-alpha, antagonist
Deposited on 2004-10-08, released 2004-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR1, NR3A1, ESR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xp6a_
  • Heterogens: AIU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xp6A (A:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
    ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
    hrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xp6A (A:)
    alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
    ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
    hrlha