PDB entry 1xoy

View 1xoy on RCSB PDB site
Description: solution structure of at3g04780.1, an arabidopsis ortholog of the c- terminal domain of human thioredoxin-like protein
Deposited on 2004-10-07, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1xoya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xoyA (A:)
  ssaesasqipkgqvdlldfidwsgveclnqssshslpnalkqgyredeglnlesdadeql
  liyipfnqviklhsfaikgpeeegpktvkffsnkehmcfsnvndfppsdtaelteenlkg
  kpvvlkyvkfqnvrsltifieanqsgsevtkvqkialygst