PDB entry 1xod

View 1xod on RCSB PDB site
Description: Crystal structure of X. tropicalis Spred1 EVH-1 domain
Class: Signaling Protein
Keywords: Spred, Sprouty, EVH1, Peptide-binding, Signaling Protein
Deposited on 2004-10-06, released 2005-01-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.155
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spred1
    Species: Xenopus tropicalis [TaxId:8364]
    Gene: Spred1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1xoda1
  • Chain 'B':
    Compound: Spred1
    Species: Xenopus tropicalis [TaxId:8364]
    Gene: Spred1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q66JG9 (2-117)
      • cloning artifact (0-1)
    Domains in SCOPe 2.04: d1xodb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xodA (A:)
    gsddsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdk
    tvvlecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xodA (A:)
    syarvravvmtrddssggwlqlgggglssvtvsktteflvhgerlrdktvvlecvlrrdl
    vynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xodB (B:)
    gsddsyarvravvmtrddssggwlqlgggglssvtvsktlqpgdsggteflvhgerlrdk
    tvvlecvlrrdlvynkvtptfhhwrigdkkfgltfqspadarafdrgirraiedlsqg