PDB entry 1xob

View 1xob on RCSB PDB site
Description: thioredoxin (reduced dithio form), nmr, 20 structures
Deposited on 1995-11-28, released 1996-06-10
The last revision prior to the SCOP 1.67 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1xoba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xobA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla