PDB entry 1xoa

View 1xoa on RCSB PDB site
Description: thioredoxin (oxidized disulfide form), nmr, 20 structures
Deposited on 1995-11-28, released 1996-06-10
The last revision prior to the SCOP 1.69 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1xoa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xoa_ (-)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla