PDB entry 1xmw

View 1xmw on RCSB PDB site
Description: cd3 epsilon and delta ectodomain fragment complex in single-chain construct
Class: signaling protein
Keywords: beta-sheet, c1-set immunoglobulin superfamily, h-bonded g strand pair, single-chain
Deposited on 2004-10-04, released 2004-11-30
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-30, with a file datestamp of 2007-06-14.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chimeric CD3 mouse Epsilon and sheep Delta Ectodomain Fragment Complex
    Species: Mus Musculus, Ovis Aries
    Gene: CD3E, CD3D
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xmwa1, d1xmwa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xmwA (A:)
    ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy
    vcytpasnkntylylkarvgsaddakkdaakkddakkddakkdgsqtnkakralevleae
    dkvilkcnssitllqgtagqevsdnktlnlgkriedprgmyqcgenaksftlqvyyrm