PDB entry 1xme

View 1xme on RCSB PDB site
Description: Structure of Recombinant Cytochrome ba3 Oxidase from Thermus thermophilus
Class: oxidoreductase
Keywords: cytochrome oxidase, heme, heme-as, integral membrane protein, oxidoreductase
Deposited on 2004-10-01, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase polypeptide I
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xmea_
  • Chain 'B':
    Compound: cytochrome c oxidase polypeptide II
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xmeb1, d1xmeb2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide IIA
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xmec_
  • Heterogens: BNG, CU, HEM, HAS, CUA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmeA (A:)
    mhhhhhhavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypl
    lkrllpfvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmaf
    iglvvaalpllaneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaan
    pgkvtplvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghp
    ivyfwllpayaiiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptw
    kmihsvltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgll
    gfipggaggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpis
    daqrrlglavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlag
    ivllvalllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfava
    ailvvlaygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmeA (A:)
    seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy
    yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll
    aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym
    avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya
    iiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv
    avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv
    nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv
    wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi
    yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt
    lvqlfghlnpvpgwrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmeB (B:)
    mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmeB (B:)
    dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xmeC (C:)
    meekpkgalavilvltltilvfwlgvyavffarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmeC (C:)
    eekpkgalavilvltltilvfwlgvyavffarg