PDB entry 1xm6

View 1xm6 on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With (R)-Mesopram
Class: hydrolase
Keywords: PDE4B, (R)-Mesopram, HYDROLASE
Deposited on 2004-10-01, released 2004-12-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xm6a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xm6b_
  • Heterogens: ZN, MG, 5RM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xm6A (A:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsp
    pldeqnrdcqglmekfqfeltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm6A (A:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmipcqglmekfqfeltld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xm6B (B:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsp
    pldeqnrdcqglmekfqfeltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm6B (B:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmipglmekfqfelt