PDB entry 1xm5

View 1xm5 on RCSB PDB site
Description: crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054
Deposited on 2004-10-01, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xm5a_
  • Chain 'B':
    Domains in SCOP 1.71: d1xm5b_
  • Chain 'C':
    Domains in SCOP 1.71: d1xm5c_
  • Chain 'D':
    Domains in SCOP 1.71: d1xm5d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xm5A (A:)
    msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg
    kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll
    gydhieddeaeemealeteimlalgyedpyiaeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm5A (A:)
    msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg
    kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll
    gydhieddeaeemealeteimlalgyedpyia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xm5B (B:)
    msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg
    kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll
    gydhieddeaeemealeteimlalgyedpyiaeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm5B (B:)
    msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg
    kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll
    gydhieddeaeemealeteimlalgyedpyia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xm5C (C:)
    msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg
    kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll
    gydhieddeaeemealeteimlalgyedpyiaeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm5C (C:)
    qvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrgkd
    kptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhllgy
    dhieddeaeemealeteimlalgyedpy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xm5D (D:)
    msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg
    kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll
    gydhieddeaeemealeteimlalgyedpyiaeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm5D (D:)
    msqvildlqlacednsglpeesqfqtwlnavipqfqeesevtirvvdtaeshslnltyrg
    kdkptnvlsfpfevppgmemsllgdlvicrqvvekeaqeqgkpleahwahmvvhgslhll
    gydhieddeaeemealeteimlalgyedpyia