PDB entry 1xm4

View 1xm4 on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With Piclamilast
Class: hydrolase
Keywords: PDE4B, Piclamilast, HYDROLASE
Deposited on 2004-10-01, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.215
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07343
      • modified residue (63)
      • modified residue (301)
    Domains in SCOPe 2.07: d1xm4a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07343
      • modified residue (63)
      • modified residue (189)
    Domains in SCOPe 2.07: d1xm4b_
  • Heterogens: ZN, MG, PIL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xm4A (A:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsp
    pldeqnrdcqglmekfqfeltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm4A (A:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xm4B (B:)
    mgsshhhhhhssglvprgshmsisrfgvntenedhlakeledlnkwglnifnvagyshnr
    pltcimyaifqerdllktfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvll
    stpaldavftdleilaaifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlav
    gfkllqeehcdifmnltkkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssg
    vllldnytdriqvlrnmvhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeisp
    mcdkhtasveksqvgfidyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsp
    pldeqnrdcqglmekfqfeltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xm4B (B:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmip