PDB entry 1xkv

View 1xkv on RCSB PDB site
Description: Crystal Structure Of ATP-Dependent Phosphoenolpyruvate Carboxykinase From Thermus thermophilus HB8
Class: lyase
Keywords: Phosphoenolpyruvate Carboxykinase, adenosine triphosphate, Thermus thermophilus, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2004-09-29, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent phosphoenolpyruvate carboxykinase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xkva1, d1xkva2
  • Chain 'B':
    Compound: ATP-dependent phosphoenolpyruvate carboxykinase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xkvb1, d1xkvb2
  • Heterogens: CA, PO4, ATP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xkvA (A:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgekirkhapr
    vylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpq
    ellnpretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkvA (A:)
    qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
    epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
    spwhalfarnmfilprrfgafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvliv
    gtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgkttlstdper
    pligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvvnpesrrv
    qwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarlspeeamyy
    flsgytarvtepratfsacfgapflpmhpgvyarmlgekirkhaprvylvntgwtggpyg
    vgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqellnpretwadkea
    ydqqarklarlfqenfqkyasgvakevaeagprte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xkvB (B:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvagtergvtepratfsacfgapflpmhpgvyarmlgekirkhapr
    vylvntgwtggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpq
    ellnpretwadkeaydqqarklarlfqenfqkyasgvakevaeagprte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xkvB (B:)
    mqrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvv
    repevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvt
    espwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfq
    rrlvlivgtkyageikksiftvmnylmpkrgvfpmhasanvgkegdvavffglsgtgktt
    lstdperpligddehgwsedgvfnfeggcyakvirlspehepliykasnqfeailenvvv
    npesrrvqwdddsktentrssypiahlenvvesgvaghpraifflsadaygvlppiarls
    peeamyyflsgytarvpratfsacfgapflpmhpgvyarmlgekirkhaprvylvntgwt
    ggpygvgyrfplpvtrallkaalsgalenvpyrrdpvfgfevpleapgvpqellnpretw
    adkeaydqqarklarlfqenfqkyasgvakevaeagprt