PDB entry 1xkj

View 1xkj on RCSB PDB site
Description: bacterial luciferase beta2 homodimer
Class: luminescence
Keywords: luciferase, luminescence, photoprotein, oxidoreductase
Deposited on 1996-10-08, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta2 luciferase
    Species: Vibrio harveyi [TaxId:669]
    Gene: VIBRIO HARVEYI LUXAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xkja_
  • Chain 'B':
    Compound: beta2 luciferase
    Species: Vibrio harveyi [TaxId:669]
    Gene: VIBRIO HARVEYI LUXAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xkjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xkjA (A:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnanivkyhs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xkjB (B:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnanivkyhs