PDB entry 1xju

View 1xju on RCSB PDB site
Description: Crystal structure of secreted inactive form of P1 phage endolysin Lyz
Class: hydrolase
Keywords: secreted inactive conformation
Deposited on 2004-09-24, released 2005-01-11
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.134
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Bacteriophage P1
    Gene: 17, LYSA, lyZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q37875 (0-156)
      • his tag (157)
    Domains in SCOP 1.73: d1xjua_
  • Chain 'B':
    Compound: lysozyme
    Species: Bacteriophage P1
    Gene: 17, LYSA, lyZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q37875 (0-156)
      • his tag (157)
    Domains in SCOP 1.73: d1xjub_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjuA (A:)
    rtnqaglelignaegcrrdpymcpagvwtdgignthgvtpgvrktdqqiaadweknilia
    ercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvn
    mcnhlpdfvnsngvplrglkirrekerqlcltglvnehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjuA (A:)
    rtnqaglelignaegcrrdpymcpagvwtdgigngvtpgvrktdqqiaadwekniliaer
    cinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvnmc
    nhlpdfvnsngvplrglkirrekerqlcltglvneh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xjuB (B:)
    rtnqaglelignaegcrrdpymcpagvwtdgignthgvtpgvrktdqqiaadweknilia
    ercinqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvn
    mcnhlpdfvnsngvplrglkirrekerqlcltglvnehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjuB (B:)
    rtnqaglelignaegcrrdpymcpagvwtdgiggvtpgvrktdqqiaadwekniliaerc
    inqhfrgkdmpdnafsamtsaafnmgcnslrtyyskargmrvetsihkwaqkgewvnmcn
    hlpdfvnsngvplrglkirrekerqlcltglvneh