PDB entry 1xjo

View 1xjo on RCSB PDB site
Description: structure of aminopeptidase
Deposited on 1996-10-09, released 1997-04-01
The last revision prior to the SCOP 1.63 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.141
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1xjo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1xjo_ (-)
    apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
    gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
    khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
    tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
    afdrcyhsscdslsnindtaldrnsdaaahaiwtlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjo_ (-)
    apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
    gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
    khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
    tfknyfaglnvpteirsdhapfknvgvpvgglftgagytksaaqaqkwggtagqafdrcy
    hsscdslsnindtaldrnsdaaahaiwtlss