PDB entry 1xj7

View 1xj7 on RCSB PDB site
Description: Complex Androgen Receptor LBD and RAC3 peptide
Class: hormone/growth factor
Keywords: Androgen receptor coactivators LXXLL motif, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2004-09-22, released 2005-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xj7a_
  • Chain 'B':
    Compound: RAC3 derived peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XJ7 (0-8)
  • Heterogens: DHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xj7A (A:)
    hiegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakal
    pgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmys
    qcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldrii
    ackrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvq
    vpkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xj7A (A:)
    hiegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakal
    pgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmys
    qcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldrii
    ackrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvq
    vpkilsgkvkpiyfht
    

  • Chain 'B':
    No sequence available.