PDB entry 1xiu

View 1xiu on RCSB PDB site
Description: Crystal structure of the agonist-bound ligand-binding domain of Biomphalaria glabrata RXR
Class: transcription/transferase
Keywords: Nuclear Receptor, Protein-Ligand complex, Retinoid Receptor, TRANSCRIPTION-TRANSFERASE COMPLEX
Deposited on 2004-09-22, released 2005-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RXR-like protein
    Species: Biomphalaria glabrata [TaxId:6526]
    Gene: RXR
    Database cross-references and differences (RAF-indexed):
    • GB AAL86461
    Domains in SCOPe 2.06: d1xiua_
  • Chain 'B':
    Compound: RXR-like protein
    Species: Biomphalaria glabrata [TaxId:6526]
    Gene: RXR
    Database cross-references and differences (RAF-indexed):
    • GB AAL86461
    Domains in SCOPe 2.06: d1xiub_
  • Chain 'E':
    Compound: Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xiuA (A:)
    ganndmpveqileaelavdpkidtyidaqkdpvtnicqaadkqlftlvewakriphftel
    pledqvillragwnelliagfshrsimakdgillatglhvhrssahqagvgtifdrvlte
    lvakmrdmkmdktelgclravvlfnpdakgltavqeveqlrekvyasleeytksrypeep
    grfaklllrlpalrsiglkclehlfffkligdqpidtflmemlenpspat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiuA (A:)
    ndmpveqileaelavdpkidtyidaqkdpvtnicqaadkqlftlvewakriphftelple
    dqvillragwnelliagfshrsimakdgillatglhvhrssahqagvgtifdrvltelva
    kmrdmkmdktelgclravvlfnpdakgltavqeveqlrekvyasleeytksrypeepgrf
    aklllrlpalrsiglkclehlfffkligdqpidtflmemle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xiuB (B:)
    ganndmpveqileaelavdpkidtyidaqkdpvtnicqaadkqlftlvewakriphftel
    pledqvillragwnelliagfshrsimakdgillatglhvhrssahqagvgtifdrvlte
    lvakmrdmkmdktelgclravvlfnpdakgltavqeveqlrekvyasleeytksrypeep
    grfaklllrlpalrsiglkclehlfffkligdqpidtflmemlenpspat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xiuB (B:)
    nndmpveqileaelavdpkidtyidaqkdpvtnicqaadkqlftlvewakriphftelpl
    edqvillragwnelliagfshrsimakdgillatglhvhrssahqagvgtifdrvltelv
    akmrdmkmdktelgclravvlfnpdakgltavqeveqlrekvyasleeytksrypeepgr
    faklllrlpalrsiglkclehlfffkligdqpidtflmemlenp
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.