PDB entry 1xhf

View 1xhf on RCSB PDB site
Description: Crystal structure of the bef3-activated receiver domain of redox response regulator arca
Class: transcription
Keywords: Two-Component System; Gene Regulation; Transcription Factor; Anoxic Redox Control; Doubly Wound Five-Stranded Beta/Alpha Fold
Deposited on 2004-09-18, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aerobic respiration control protein arcA
    Species: Escherichia coli [TaxId:562]
    Gene: arcA, dye, fexA, sfrA, seg, msp, cpxC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9Q1
      • modified residue (38)
      • modified residue (52)
      • modified residue (77)
      • modified residue (121)
    Domains in SCOPe 2.07: d1xhfa_
  • Chain 'B':
    Compound: Aerobic respiration control protein arcA
    Species: Escherichia coli [TaxId:562]
    Gene: arcA, dye, fexA, sfrA, seg, msp, cpxC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9Q1 (0-End)
      • modified residue (0)
      • modified residue (38)
      • modified residue (52)
      • modified residue (77)
      • modified residue (121)
    Domains in SCOPe 2.07: d1xhfb_
  • Heterogens: MG, BEF, BF4, BF2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhfA (A:)
    mqtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgk
    nglllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsr
    tmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhfA (A:)
    qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn
    glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt
    m
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xhfB (B:)
    mqtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgk
    nglllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsr
    tmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhfB (B:)
    mqtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgk
    nglllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsr
    tm