PDB entry 1xfx

View 1xfx on RCSB PDB site
Description: Crystal structure of anthrax edema factor (EF) in complex with calmodulin in the presence of 10 millimolar exogenously added calcium chloride
Class: lyase/metal binding protein
Keywords: protein-protein interaction, LYASE/METAL BINDING PROTEIN COMPLEX
Deposited on 2004-09-15, released 2005-05-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.262
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (Start-148)
      • modified residue (36)
      • modified residue (51)
      • modified residue (71-72)
      • modified residue (76)
      • modified residue (109)
      • modified residue (124)
      • modified residue (144-145)
    Domains in SCOPe 2.02: d1xfxo1
  • Chain 'P':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (Start-148)
      • modified residue (36)
      • modified residue (51)
      • modified residue (71-72)
      • modified residue (76)
      • modified residue (109)
      • modified residue (124)
      • modified residue (144-145)
    Domains in SCOPe 2.02: d1xfxp1
  • Chain 'Q':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (Start-148)
      • modified residue (36)
      • modified residue (51)
      • modified residue (71-72)
      • modified residue (76)
      • modified residue (109)
      • modified residue (124)
      • modified residue (144-145)
    Domains in SCOPe 2.02: d1xfxq1
  • Chain 'R':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (Start-148)
      • modified residue (36)
      • modified residue (51)
      • modified residue (71-72)
      • modified residue (76)
      • modified residue (109)
      • modified residue (124)
      • modified residue (144-145)
    Domains in SCOPe 2.02: d1xfxr1
  • Chain 'S':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (Start-148)
      • modified residue (36)
      • modified residue (51)
      • modified residue (71-72)
      • modified residue (76)
      • modified residue (109)
      • modified residue (124)
      • modified residue (144-145)
    Domains in SCOPe 2.02: d1xfxs1
  • Chain 'T':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62158 (Start-148)
      • modified residue (36)
      • modified residue (51)
      • modified residue (71-72)
      • modified residue (76)
      • modified residue (109)
      • modified residue (124)
      • modified residue (144-145)
    Domains in SCOPe 2.02: d1xfxt1
  • Heterogens: MG, CA

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1xfxO (O:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfxO (O:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1xfxP (P:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfxP (P:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1xfxQ (Q:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfxQ (Q:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1xfxR (R:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfxR (R:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1xfxS (S:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfxS (S:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1xfxT (T:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfxT (T:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak