PDB entry 1xft

View 1xft on RCSB PDB site
Description: Synchrotron X-ray Powder Diffraction Study of Hexagonal Turkey Egg-white Lysozyme
Class: hydrolase
Keywords: powder diffraction, lysozyme, x-rays
Deposited on 2004-09-15, released 2005-04-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.113
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Meleagris gallopavo
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1xfta1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xftA (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xftA (A:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcr