PDB entry 1xfo

View 1xfo on RCSB PDB site
Description: Crystal Structure of an archaeal aminopeptidase
Class: hydrolase
Keywords: aminopeptidase, self-compartmentalizing, metalloprotease, x-ray diffraction, crystal structure, dinuclear
Deposited on 2004-09-15, released 2004-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.183
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frv operon protein FrvX
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59196 (4-356)
      • his tag (0-3)
    Domains in SCOP 1.75: d1xfoa1, d1xfoa2
  • Chain 'B':
    Compound: Frv operon protein FrvX
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xfob1, d1xfob2
  • Chain 'C':
    Compound: Frv operon protein FrvX
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xfoc1, d1xfoc2
  • Chain 'D':
    Compound: Frv operon protein FrvX
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xfod1, d1xfod2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xfoA (A:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrf
    vsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidv
    tiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgg
    gtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfoA (A:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriav
    ytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpe
    hkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgggtdagaihltk
    agvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xfoB (B:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrf
    vsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidv
    tiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgg
    gtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfoB (B:)
    mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
    aahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpapdw
    dqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriavytilevakq
    lkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpehkqvthlgk
    gtaikimdrsvichptivrwleelakkheipyqleillgggtdagaihltkagvptgals
    vparyihsntevvderdvdatvelmtkalenihelki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xfoC (C:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrf
    vsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidv
    tiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgg
    gtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfoC (C:)
    mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
    aahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpapdw
    dqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriavytilevakq
    lkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpehkqvthlgk
    gtaikimdrsvichptivrwleelakkheipyqleillgggtdagaihltkagvptgals
    vparyihsntevvderdvdatvelmtkalenihelki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xfoD (D:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrf
    vsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidv
    tiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgg
    gtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfoD (D:)
    mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
    aahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpapdw
    dqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriavytilevakq
    lkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpehkqvthlgk
    gtaikimdrsvichptivrwleelakkheipyqleillgggtdagaihltkagvptgals
    vparyihsntevvderdvdatvelmtkalenihelki