PDB entry 1xfo

View 1xfo on RCSB PDB site
Description: Crystal Structure of an archaeal aminopeptidase
Deposited on 2004-09-15, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xfoA (A:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrf
    vsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidv
    tiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgg
    gtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfoA (A:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriav
    ytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpe
    hkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgggtdagaihltk
    agvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xfoB (B:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrf
    vsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidv
    tiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgg
    gtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfoB (B:)
    mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
    aahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpapdw
    dqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriavytilevakq
    lkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpehkqvthlgk
    gtaikimdrsvichptivrwleelakkheipyqleillgggtdagaihltkagvptgals
    vparyihsntevvderdvdatvelmtkalenihelki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xfoC (C:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrf
    vsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidv
    tiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgg
    gtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfoC (C:)
    mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
    aahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpapdw
    dqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriavytilevakq
    lkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpehkqvthlgk
    gtaikimdrsvichptivrwleelakkheipyqleillgggtdagaihltkagvptgals
    vparyihsntevvderdvdatvelmtkalenihelki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xfoD (D:)
    rgshmevrnmvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahk
    kgegpkvmiaahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygv
    gasvpphiqkpedrkkapdwdqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrf
    vsiafddriavytilevakqlkdakadvyfvatvqeevglrgartsafgiepdygfaidv
    tiaadipgtpehkqvthlgkgtaikimdrsvichptivrwleelakkheipyqleillgg
    gtdagaihltkagvptgalsvparyihsntevvderdvdatvelmtkalenihelki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfoD (D:)
    mvdyellkkvveapgvsgyeflgirdvvieeikdyvdevkvdklgnviahkkgegpkvmi
    aahmdqiglmvthiekngflrvapiggvdpktliaqrfkvwidkgkfiygvgasvpapdw
    dqifidigaeskeeaedmgvkigtvitwdgrlerlgkhrfvsiafddriavytilevakq
    lkdakadvyfvatvqeevglrgartsafgiepdygfaidvtiaadipgtpehkqvthlgk
    gtaikimdrsvichptivrwleelakkheipyqleillgggtdagaihltkagvptgals
    vparyihsntevvderdvdatvelmtkalenihelki