PDB entry 1xfl

View 1xfl on RCSB PDB site
Description: Solution Structure of Thioredoxin h1 from Arabidopsis Thaliana
Class: electron transport
Keywords: AT3G51030, thioredoxin, structural genomics, protein structure initiative, CESG, PSI, Center for Eukaryotic Structural Genomics, ELECTRON TRANSPORT
Deposited on 2004-09-15, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin h1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g51030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xflA (A:)
    mghhhhhhlemaseegqviachtvetwneqlqkanesktlvvvdftaswcgpcrfiapff
    adlakklpnvlflkvdtdelksvasdwaiqamptfmflkegkildkvvgakkdelqstia
    khla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xflA (A:)
    maseegqviachtvetwneqlqkanesktlvvvdftaswcgpcrfiapffadlakklpnv
    lflkvdtdelksvasdwaiqamptfmflkegkildkvvgakkdelqstiakhla