PDB entry 1xf6

View 1xf6 on RCSB PDB site
Description: High resolution crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas CS24
Class: photosynthesis
Keywords: phycoerythrin, light-harvesting protein, cryptophyte
Deposited on 2004-09-14, released 2004-11-30
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.097
AEROSPACI score: 1.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phycoerythrin alpha-3 chain
    Species: Rhodomonas sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00433 (0-75)
      • modified residue (3)
    Domains in SCOP 1.75: d1xf6a_
  • Chain 'B':
    Compound: Phycoerythrin alpha-2 chain
    Species: Rhodomonas sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1xf6b_
  • Chain 'C':
    Compound: B-phycoerythrin beta chain
    Species: Rhodomonas sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27198 (Start-176)
      • conflict (49)
      • conflict (55)
      • conflict (60)
      • conflict (64)
      • modified residue (71)
      • conflict (72)
    Domains in SCOP 1.75: d1xf6c_
  • Chain 'D':
    Compound: B-phycoerythrin beta chain
    Species: Rhodomonas sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27198 (0-176)
      • conflict (49)
      • conflict (55)
      • conflict (60)
      • conflict (64)
      • modified residue (71)
      • conflict (72)
    Domains in SCOP 1.75: d1xf6d_
  • Heterogens: CL, MG, DBV, PEB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xf6A (A:)
    amdksakapqitifdhrgcsrapkestggkaggqddemmvkvastkvtvsesdaakklqe
    fitfekgidgpftskn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xf6B (B:)
    amdksakapvitifdhrgcsrapkeytgakaggkddemmvkaqsvkievstgtaegvlat
    slakmtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xf6C (C:)
    mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
    cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
    gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xf6C (C:)
    dafsrvvadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicenp
    slispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvpa
    nsnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xf6D (D:)
    mldafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmi
    cenpslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketyssl
    gvpansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais