PDB entry 1xeu

View 1xeu on RCSB PDB site
Description: Crystal Structure of Internalin C from Listeria monocytogenes
Class: cell invasion
Keywords: Listeria monocytogenes; cellular invasion; internalin C; leucine-rich repeat; crystal structure, CELL INVASION
Deposited on 2004-09-13, released 2005-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.202
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: internalin C
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: inlC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xeua1, d1xeua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xeuA (A:)
    esiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslagmq
    fftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnelrd
    tdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwidlt
    gqkcvnepvkyqpelyitntvkdpdgrwispyyisnggsyvdgcvlwelpvytdevsykf
    seyinvgeteaifdgtvtqpikn