PDB entry 1xet

View 1xet on RCSB PDB site
Description: Crystal structure of stilbene synthase from Pinus sylvestris, complexed with methylmalonyl CoA
Class: transferase
Keywords: transferase
Deposited on 2004-09-12, released 2006-04-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xeta1, d1xeta2
  • Chain 'B':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xetb1, d1xetb2
  • Chain 'C':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xetc1, d1xetc2
  • Chain 'D':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xetd1, d1xetd2
  • Heterogens: 3IO, MCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xetA (A:)
    mgsshhhhhhssglvprgshmggvdfegfrklqradgfasilaigtanppnavdqstypd
    fyfritgnehntelkdkfkricersaikqrymylteeilkknpdvcafvevpsldarqam
    lamevprlakeaaekaiqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrv
    gvfqhgcfaggtvlrmakdlaennrgarvlvicsettavtfrgpsethldslvgqalfgd
    gasalivgadpipqvekacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisa
    niencmveafsqfkisdwnklfwvvhpggraildrveaklnldptkliptrhvmseygnm
    ssacvhfildqtrkaslqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xetA (A:)
    fegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricers
    aikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsks
    githlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennr
    garvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivwt
    aqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwvv
    hpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcsttg
    eglemgvlfgfgpgltietvvlksvpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xetB (B:)
    mgsshhhhhhssglvprgshmggvdfegfrklqradgfasilaigtanppnavdqstypd
    fyfritgnehntelkdkfkricersaikqrymylteeilkknpdvcafvevpsldarqam
    lamevprlakeaaekaiqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrv
    gvfqhgcfaggtvlrmakdlaennrgarvlvicsettavtfrgpsethldslvgqalfgd
    gasalivgadpipqvekacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisa
    niencmveafsqfkisdwnklfwvvhpggraildrveaklnldptkliptrhvmseygnm
    ssacvhfildqtrkaslqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xetB (B:)
    fegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricers
    aikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsks
    githlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennr
    garvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivwt
    aqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwvv
    hpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcsttg
    eglemgvlfgfgpgltietvvlksvpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xetC (C:)
    mgsshhhhhhssglvprgshmggvdfegfrklqradgfasilaigtanppnavdqstypd
    fyfritgnehntelkdkfkricersaikqrymylteeilkknpdvcafvevpsldarqam
    lamevprlakeaaekaiqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrv
    gvfqhgcfaggtvlrmakdlaennrgarvlvicsettavtfrgpsethldslvgqalfgd
    gasalivgadpipqvekacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisa
    niencmveafsqfkisdwnklfwvvhpggraildrveaklnldptkliptrhvmseygnm
    ssacvhfildqtrkaslqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xetC (C:)
    vdfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehnfkricersaikq
    rymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsksgith
    lifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennrgarv
    lvicsettavtfrgpsethdslvgqalfgdgasalivgadpipqvekacfeivwtaqtvv
    pnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwvvhpggr
    aildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcsttgeglem
    gvlfgfgpgltietvvlksvpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xetD (D:)
    mgsshhhhhhssglvprgshmggvdfegfrklqradgfasilaigtanppnavdqstypd
    fyfritgnehntelkdkfkricersaikqrymylteeilkknpdvcafvevpsldarqam
    lamevprlakeaaekaiqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrv
    gvfqhgcfaggtvlrmakdlaennrgarvlvicsettavtfrgpsethldslvgqalfgd
    gasalivgadpipqvekacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisa
    niencmveafsqfkisdwnklfwvvhpggraildrveaklnldptkliptrhvmseygnm
    ssacvhfildqtrkaslqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xetD (D:)
    fegfrklqradgfasilaigtanppnavdqstypdfyfritgnehndkfkricersaikq
    rymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsksgith
    lifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennrgarv
    lvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivwtaqtv
    vpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwvvhpgg
    raildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcsttgegle
    mgvlfgfgpgltietvvlksvpiq