PDB entry 1xes

View 1xes on RCSB PDB site
Description: Crystal structure of stilbene synthase from Pinus sylvestris
Class: transferase
Keywords: native structure, TRANSFERASE
Deposited on 2004-09-12, released 2006-04-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: STS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xesa1, d1xesa2
  • Chain 'B':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: STS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xesb1, d1xesb2
  • Chain 'C':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: STS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xesc1, d1xesc2
  • Chain 'D':
    Compound: Dihydropinosylvin synthase
    Species: Pinus sylvestris [TaxId:3349]
    Gene: STS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1xesd1, d1xesd2
  • Heterogens: 3IO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xesA (A:)
    mgsshhhhhhssglvprgshmggvdfegfrklqradgfasilaigtanppnavdqstypd
    fyfritgnehntelkdkfkricersaikqrymylteeilkknpdvcafvevpsldarqam
    lamevprlakeaaekaiqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrv
    gvfqhgcfaggtvlrmakdlaennrgarvlvicsettavtfrgpsethldslvgqalfgd
    gasalivgadpipqvekacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisa
    niencmveafsqfkisdwnklfwvvhpggraildrveaklnldptkliptrhvmseygnm
    ssacvhfildqtrkaslqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xesA (A:)
    fegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricers
    aikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsks
    githlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennr
    garvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivwt
    aqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwvv
    hpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcsttg
    eglemgvlfgfgpgltietvvlksvpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xesB (B:)
    mgsshhhhhhssglvprgshmggvdfegfrklqradgfasilaigtanppnavdqstypd
    fyfritgnehntelkdkfkricersaikqrymylteeilkknpdvcafvevpsldarqam
    lamevprlakeaaekaiqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrv
    gvfqhgcfaggtvlrmakdlaennrgarvlvicsettavtfrgpsethldslvgqalfgd
    gasalivgadpipqvekacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisa
    niencmveafsqfkisdwnklfwvvhpggraildrveaklnldptkliptrhvmseygnm
    ssacvhfildqtrkaslqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xesB (B:)
    fegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricers
    aikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsks
    githlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennr
    garvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivwt
    aqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwvv
    hpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcsttg
    eglemgvlfgfgpgltietvvlksvpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xesC (C:)
    mgsshhhhhhssglvprgshmggvdfegfrklqradgfasilaigtanppnavdqstypd
    fyfritgnehntelkdkfkricersaikqrymylteeilkknpdvcafvevpsldarqam
    lamevprlakeaaekaiqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrv
    gvfqhgcfaggtvlrmakdlaennrgarvlvicsettavtfrgpsethldslvgqalfgd
    gasalivgadpipqvekacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisa
    niencmveafsqfkisdwnklfwvvhpggraildrveaklnldptkliptrhvmseygnm
    ssacvhfildqtrkaslqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xesC (C:)
    fegfrklqradgfasilaigtanppnavdqstypdfyfritgnekfkricersaikqrym
    ylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsksgithlif
    cstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennrgarvlvi
    csettavtfrgpsethslvgqalfgdgasalivgadpipqvekacfeivwtaqtvvpnse
    gaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwvvhpggraild
    rveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcsttgeglemgvlf
    gfgpgltietvvlksvpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xesD (D:)
    mgsshhhhhhssglvprgshmggvdfegfrklqradgfasilaigtanppnavdqstypd
    fyfritgnehntelkdkfkricersaikqrymylteeilkknpdvcafvevpsldarqam
    lamevprlakeaaekaiqewgqsksgithlifcstttpdlpgadfevakllglhpsvkrv
    gvfqhgcfaggtvlrmakdlaennrgarvlvicsettavtfrgpsethldslvgqalfgd
    gasalivgadpipqvekacfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisa
    niencmveafsqfkisdwnklfwvvhpggraildrveaklnldptkliptrhvmseygnm
    ssacvhfildqtrkaslqngcsttgeglemgvlfgfgpgltietvvlksvpiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xesD (D:)
    fegfrklqradgfasilaigtanppnavdqstypdfyfritgnelkdkfkricsaikqry
    mylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsksgithli
    fcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennrgarvlv
    icsettavtfrgpsethldslvgqalfgdgasalivgadpipqvekacfeivwtaqtvvp
    nsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdwnklfwvvhpggra
    ildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslqngcsttgeglemg
    vlfgfgpgltietvvlksvpiq