PDB entry 1xed

View 1xed on RCSB PDB site
Description: Crystal Structure of a Ligand-Binding Domain of the Human Polymeric Ig Receptor, pIgR
Class: immune system
Keywords: Ig-like fold, IMMUNE SYSTEM
Deposited on 2004-09-10, released 2004-11-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymeric-immunoglobulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PIGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01833 (Start-108)
      • expression tag (109-116)
    Domains in SCOPe 2.01: d1xeda_
  • Chain 'B':
    Compound: Polymeric-immunoglobulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PIGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01833 (Start-108)
      • expression tag (109-115)
    Domains in SCOPe 2.01: d1xedb_
  • Chain 'C':
    Compound: Polymeric-immunoglobulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PIGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01833 (Start-108)
      • expression tag (109-111)
    Domains in SCOPe 2.01: d1xedc_
  • Chain 'D':
    Compound: Polymeric-immunoglobulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PIGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01833 (Start-108)
      • expression tag (109-111)
    Domains in SCOPe 2.01: d1xedd_
  • Chain 'E':
    Compound: Polymeric-immunoglobulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PIGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01833 (Start-108)
      • expression tag (109-111)
    Domains in SCOPe 2.01: d1xede_
  • Chain 'F':
    Compound: Polymeric-immunoglobulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PIGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01833 (Start-108)
      • expression tag (109-111)
    Domains in SCOPe 2.01: d1xedf_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xedA (A:)
    kspifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvssky
    agranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xedA (A:)
    spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranl
    tnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xedB (B:)
    kspifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvssky
    agranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xedB (B:)
    pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranlt
    nfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xedC (C:)
    kspifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvssky
    agranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xedC (C:)
    pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranlt
    nfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xedD (D:)
    kspifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvssky
    agranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xedD (D:)
    pifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqcitlissegyvsskyagranlt
    nfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xedE (E:)
    kspifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvssky
    agranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xedE (E:)
    spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskya
    granltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xedF (F:)
    kspifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvssky
    agranltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xedF (F:)
    spifgpeevnsvegnsvsitcyypptsvnrhtrkywcrqgarggcitlissegyvsskya
    granltnfpengtfvvniaqlsqddsgrykcglginsrglsfdvslevleh