PDB entry 1xdv

View 1xdv on RCSB PDB site
Description: Experimentally Phased Structure of Human the Son of Sevenless protein at 4.1 Ang.
Class: signaling protein
Keywords: nucleotide exchange factor, Ras, Cdc25, Ras exchanger motif (Rem), Dbl homology(DH), pleckstrin homology (PH), SIGNALING PROTEIN
Deposited on 2004-09-08, released 2004-11-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Son of sevenless protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SOS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xdva1, d1xdva2, d1xdva3
  • Chain 'B':
    Compound: Son of sevenless protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SOS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xdvb1, d1xdvb2, d1xdvb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdvA (A:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesacrfysqqmkgkqlaikkmneiqknidgwegkdi
    gqccnefimegtltrvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmr
    kvqindkddtneykhafeiilkdensvifsaksaeeknnwmaalislqyrstlermldvt
    mlqeekeeqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhm
    yadpnfvrtflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrf
    rkeyiqpvqlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkii
    qrkkiardngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyr
    avqpselvgsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriie
    ilqvfqelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkyla
    klrsinppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnq
    pyclrvesdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplks
    pgvrpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdvA (A:)
    tyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsvkl
    lghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlskpg
    aalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqaita
    llnvqsgmekicskslakrrlsesaikkmneiqknidgwegkdigqccnefimegtltrv
    gakherhiflfdglmiccksneyrlkekffmrkvqindkddtneykhafeiilkdensvi
    fsaksaeeknnwmaalislqyrstrlpsadvyrfaepdseeniifeegipiikagtvikl
    ierltyhmyadpnfvrtflttyrsfckpqellsliierfeipeprfrkeyiqpvqlrvln
    vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkspptvewhis
    rpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnllkmir
    httnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnsspvyrl
    dhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilkteegnpe
    vlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsmekeft
    dylfnksleieprnpkplprfpkkysyplkspgvrpsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xdvB (B:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesacrfysqqmkgkqlaikkmneiqknidgwegkdi
    gqccnefimegtltrvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmr
    kvqindkddtneykhafeiilkdensvifsaksaeeknnwmaalislqyrstlermldvt
    mlqeekeeqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhm
    yadpnfvrtflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrf
    rkeyiqpvqlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkii
    qrkkiardngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyr
    avqpselvgsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriie
    ilqvfqelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkyla
    klrsinppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnq
    pyclrvesdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplks
    pgvrpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdvB (B:)
    tyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsvkl
    lghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlskpg
    aalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqaita
    llnvqsgmekicskslakrrlsesaikkmneiqknidgwegkdigqccnefimegtltrv
    gakherhiflfdglmiccksneyrlkekffmrkvqindkddtneykhafeiilkdensvi
    fsaksaeeknnwmaalislqyrstlrlpsadvyrfaepdseeniifeegipiikagtvik
    lierltyhmyadpnfvrtflttyrsfckpqellsliierfeipeprfrkeyiqpvqlrvl
    nvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkspptvewhi
    srpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnllkmi
    rhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnsspvyr
    ldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilkteegnp
    evlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsmekef
    tdylfnksleieprnpkplprfpkkysyplkspgvrpsn