PDB entry 1xdt

View 1xdt on RCSB PDB site
Description: complex of diphtheria toxin and heparin-binding epidermal growth factor
Deposited on 1997-11-18, released 1998-02-25
The last revision prior to the SCOP 1.61 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.172
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xdtR (R:)
    pclrkykdfcihgeckyvkelrapscichpgyhgerchgls
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1xdtT (T:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacagnrvrrsvgsslscinldwdvirdktktkieslkehgpiknkmsespnktvse
    ekakqyleefhqtalehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekt
    taalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynf
    vesiinlfqvvhnsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdiki
    taentplpiagvllptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvg
    ngvhanlhvafhrsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdtT (T:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpnydddwkgfystdnkydaagys
    vdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikr
    fgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeymaqac
    agscinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtaleh
    pelselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgia
    dgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynr
    payspghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllpti
    pgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrssse
    kihsneissdsigvlgyqktvdhtkvnsklslffeiks