PDB entry 1xdd

View 1xdd on RCSB PDB site
Description: X-ray structure of LFA-1 I-domain in complex with LFA703 at 2.2A resolution
Class: immune system
Keywords: Rossman fold, I-domain, IMMUNE SYSTEM
Deposited on 2004-09-06, released 2004-09-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.164
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701
      • see remark 999 (65)
    Domains in SCOPe 2.03: d1xdda_
  • Chain 'B':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701
      • see remark 999 (65)
    Domains in SCOPe 2.03: d1xddb_
  • Heterogens: MG, AAY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xddA (A:)
    maskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdf
    sdyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeat
    dsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelq
    kkiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xddA (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xddB (B:)
    maskgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdf
    sdyvkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeat
    dsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelq
    kkiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xddB (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi