PDB entry 1xd4

View 1xd4 on RCSB PDB site
Description: Crystal structure of the DH-PH-cat module of Son of Sevenless (SOS)
Class: signaling protein
Keywords: nucleotide exchange factor, Ras, Cdc25, Ras exchanger motif (Rem), Dbl homology(DH), pleckstrin homology (PH), SIGNALING PROTEIN
Deposited on 2004-09-03, released 2004-11-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.64 Å
R-factor: 0.307
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Son of sevenless protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SOS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xd4a1, d1xd4a2, d1xd4a3
  • Chain 'B':
    Compound: Son of sevenless protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SOS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xd4b1, d1xd4b2, d1xd4b3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xd4A (A:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesacrfysqqmkgkqlaikkmneiqknidgwegkdi
    gqccnefimegtltrvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmr
    kvqindkddtneykhafeiilkdensvifsaksaeeknnwmaalislqyrstlermldvt
    mlqeekeeqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhm
    yadpnfvrtflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrf
    rkeyiqpvqlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkii
    qrkkiardngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyr
    avqpselvgsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriie
    ilqvfqelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkyla
    klrsinppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnq
    pyclrvesdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplks
    pgvrpsnprpgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xd4A (A:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesaaikkmneiqknidgwegkdigqccnefimegtl
    trvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmrkvqindkddtney
    khafeiilkdensvifsaksaeeknnwmaalislqyrstlermldvtmlqeekeeqmrlp
    sadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtflttyrsfck
    pqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvlnvcrhw
    vehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqsspptve
    whisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnll
    kmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnssp
    vyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilktee
    gnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsme
    keftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xd4B (B:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesacrfysqqmkgkqlaikkmneiqknidgwegkdi
    gqccnefimegtltrvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmr
    kvqindkddtneykhafeiilkdensvifsaksaeeknnwmaalislqyrstlermldvt
    mlqeekeeqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhm
    yadpnfvrtflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrf
    rkeyiqpvqlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkii
    qrkkiardngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyr
    avqpselvgsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriie
    ilqvfqelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkyla
    klrsinppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnq
    pyclrvesdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplks
    pgvrpsnprpgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xd4B (B:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesaaikkmneiqknidgwegkdigqccnefimegtl
    trvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmrkvqindkddtney
    khafeiilkdensvifsaksaeeknnwmaalislqyrstlermldvtmlqeekeeqmrlp
    sadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtflttyrsfck
    pqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvlnvcrhw
    vehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqsspptve
    whisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnll
    kmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnssp
    vyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilktee
    gnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsme
    keftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr